Advertise for free here!
Advertise.com.ng - Advertise For Free!
Advertise for free  Advertise For Free All Ads  Ads All Advertisers  Advertisers   Shopping cart  [0] Saved ads  [0]
find everything you need on Advertise.com.ng
For Sale •  Wanted •  For Rent •  Wish to Rent •  Swap •  Giveaway •  Job Available •  Seeking Job •  Lost •  Found •  Event •  All
All (53) Private (45) Company (8) e-Commerce (14) Sell Pets! Advertise For Free!   View without images
Image Title Like Price Date ↓ Category Province Ad type P/C Save
Samoyed adult female for sale call 09051189288 or wtsapp 07082239029...
this ad is inactive
60 000 ₦
2015-11-17 Pets Lagos For Sale [P] save
Pure Brindle Bullmastiff Puppies
We have 2 excellent brindle female bullmastiff puppies from imported pedigree bloodline parents. Age 9wks Vaccination 2 DHLPP shots already Dewormed...
this ad is inactive
120 000 ₦
2014-12-29 Pets Lagos For Sale [P] save
Cute, well trained rabbits for pet and also high quality breeding stock....
this ad is inactive
2 800 ₦
2014-12-19 Pets Abuja (FCT) For Sale [C] save
We have boerboel puppies on ground and all ready to go ,they are full breed boerboel mostly brindle colour in male and female and you can call us asap...
this ad is inactive
85 000 ₦
2014-11-10 Pets Lagos For Sale [P] save
Contact Frank for more info 08098118831...
this ad is inactive
60 000 ₦
2014-11-10 Pets Oyo For Sale [P] save
Boerboel puppies for sale
Boerboel puppies for sale with good pedigree. Going for 120,000 each, all vaccinated and well fed. And I also deal in other breeds such as Labrador,...
this ad is inactive
120 000 ₦
2014-10-30 Pets Lagos For Sale [P] save
Teacup Yorkie puppies for adoption they are male and female 12 weeks old vet checked, akc registered, vaccinated and they get along with other home...
this ad is inactive
-
2014-10-16 Pets Adamawa For Sale [P] save
These cute little pups are breed and raised at home with mom and dad. almost potty trained, doing very well. Ready to go to your forever home....
this ad is inactive
60 ₦
2014-09-26 Pets Lagos For Sale [P] save
Lhasa puppies for sale with good pedigree. Going for 70,000 each, all vaccinated and well fed. And I also deal in other breeds such as Labrador,...
this ad is inactive
70 000 ₦
2014-09-11 Pets Lagos For Sale [P] save
Pedigree Lhasa Apso Puppies for sale
At Orbit kennels we understand that homing a pet is a major decision and a dog is a member of the family, if you had the opportunity to chose a family...
this ad is inactive
80 000 ₦
2014-08-15 Pets Edo For Sale [P] save
We have a very good standard mastiff male puppy,he is 5wks and already had is first vaccination shot and regularly dewormed....
this ad is inactive
90 000 ₦
2014-08-14 Pets Lagos For Sale [P] save
mastif for sale
male mastif for sale...
this ad is inactive
70 ₦
2014-07-31 Pets Niger For Sale [P] save
Pure Breed South African boerboel for sale, cal taiwo 08022173681...
this ad is inactive
90 ₦
2014-07-09 Pets Ogun For Sale [P] save
Pedigree boerboel pups for sale
We are pleased to announce the birth of our pedigree boerboel puppies, sired by a strong, confident, muscular stud with a distinctively blocky head....
this ad is inactive
70 000 ₦
2014-06-12 Pets Lagos For Sale [P] save
lhasa puppy for sale
3moths lhasa available now for sale at affordable and negotiable price...
this ad is inactive
32 000 ₦
2014-06-05 Pets Kogi For Sale [C] save
Rottweiler for Sale in Nigeria
Buy your cute puppies/ dogs @ TopDogz Kennel. We breed dogs like †ђξ Lhasa apso, Rottweiler, Samoyed, German Shepherd Dog, Boerboel, Caucasian,...
this ad is inactive
-
2014-05-11 Pets Lagos For Sale [C] save
Dogs For sale in Ngeria
Buy your cute puppies/ dogs @ TopDogz Kennel. We breed dogs like †ђξ Lhasa apso, Rottweiler, Samoyed, German Shepherd Dog, Boerboel, Caucasian,...
this ad is inactive
-
2014-05-11 Pets Lagos For Sale [C] save
Boerboel Puppies for sale
A pure Breed Boelboel is available...
this ad is inactive
-
2014-04-16 Pets Cross River For Sale [P] save
BOERBOEL PUPPIES...
this ad is inactive
80 ₦
2014-01-29 Pets Lagos For Sale [P] save
Pedigree German Shepherd Puppies (Slant Back)
We have a litter of 6wks old german shepherd puppies. From imported parents. They are already dewormed and vaccinated to date and ready for a new...
this ad is inactive
30 000 ₦
2014-01-26 Pets Lagos For Sale [P] save
Pedigree (Male) Boerboel Puppy for Sale
TLIMS Capito, Chivas & Capone from Sire- Caberet Sylvestor (Klein Sandfotein Madoda + Caberet Kara) and Dam- HIS Elena (Bosplaas Zorro- Man U +...
this ad is inactive
120 000 ₦
2014-01-01 Pets Ogun For Sale [P] save
dog
6 weeks old,pure south african boerboel puppies for sale,pure brown and brindle colours....
this ad is inactive
85 000 ₦
2013-11-29 Pets Ogun For Sale [P] save
Champion Bloodline Boerboel puppies for sale
We have 3 months old boerboel puppies for sale. Both parents are imported and from champion bloodline.They have all there vaccines taken till date.We...
this ad is inactive
70 000 ₦
2013-11-24 Pets Lagos For Sale [P] save
AQUARIUMS FOR SALE
PORTABLE AQUARIUM FOR SALE; IT CONTAINS INBUILT POWER FILTER,SMALL AIR PUMP, 5 DIFFERENT TYPES OF ORNAMENTAL FISHES(GOLDFISH,PLATY,MOLLY,GUPPY,PEAL...
this ad is inactive
25 000 ₦
2013-10-14 Pets Ogun For Sale [C] save
We have quality dogs. We import. Breed,treat walk,cross and sell. Our branch is in ph city. Any breed you need....
this ad is inactive
80 000 ₦
2013-10-07 Pets Lagos For Sale [P] save
dogs for sale in nigeria
Buy your cute puppies/ dogs @ TopDogs Kennel. We breed dogs like †ђξ Lhasa apso, Rottweiler, Samoyed, German Shepherd Dog, Boerboel, Caucasian,...
this ad is inactive
-
2013-09-17 Pets Lagos For Sale [P] save
Buy your cute puppies/ dogs @ TopDogs Kennel. We breed dogs like †ђξ Lhasa apso, Rottweiler, Samoyed, German Shepherd Dog, Boerboel, Caucasian,...
this ad is inactive
-
2013-09-17 Pets Lagos For Sale [P] save
Pure black female alsatian 7month above @#80,000, alsatian puppy @#30,000, female dobberman 1yr above #120,000...
this ad is inactive
30 000 ₦
2013-08-16 Pets Ogun For Sale [P] save
Standard Pedigree Boerboels
We have both male and female boerboel puppies ready to go they are 7wks old they have been dewormed and inoculated up to date both parents are...
this ad is inactive
80 000 ₦
2013-07-15 Pets Ogun For Sale [P] save
Pedigree Boerboel Puppies
We have excellent pedigree boerboel puppies Age : 7wks Old Percentage : 100% Sex :Male and Female available Vaccinations : Innoculated and dewormed...
this ad is inactive
80 000 ₦
2013-07-14 Pets Ogun For Sale [P] save
box head...
this ad is inactive
999 999 999.99 ₦
2013-04-19 Pets Lagos For Sale [P] save
Puppies of all breed for sale
We've got rottweilers,Wolfdogs,st bernards,German shepherds,Dogue de bordeuax,Samoyed,Caucasion,Pugs,Poodles,Labrators,boerbels,bull mastiffs,Siberian...
this ad is inactive
100 000 ₦
2013-03-29 Pets Yobe For Sale [P] save
i have a female boer boel puppy (13 weeks ) for sale,potty trained,carton color,boxed head and going to be tall,massive pulse,fearless,DHLLP shot...
this ad is inactive
130 000 ₦
2013-02-22 Pets Lagos For Sale [P] save
I have some well bred german shepherd / alsatian puppys for sale in such reasonable price. But this offer is for only doglovers. Anytime you can call...
this ad is inactive
270 ₦
2012-12-11 Pets Lagos For Sale [P] save
Breed:Affenpinscher pets name : Kline Shottz Sex:Female Birthdate: 10-15-2012 (8 Weeks) Champion bloodlines: No Champion sired: No Price:$500 USD Buy...
this ad is inactive
500 ₦
2012-12-11 Pets Ondo For Sale [P] save
Female alsatian dog for sale. 7.5 months old, calm, good watch dog and good with kids...
this ad is inactive
55 000 ₦
2012-11-06 Pets Lagos For Sale [P] save
PURE ADULT FEMALE ROTTWEILLER
I have a 2yr old female rottweiller good for breeding and security services,she is a bit aggressive with good temperament. Call 07030601077 &...
this ad is inactive
110 000 ₦
2012-11-01 Pets Lagos For Sale [P] save
Pedigree German Shepherd Dogs { Alsatian}
I presently have four {4} German Shepherd Pedigree Dogs for sale Call 07030601077 f& or 08023298256 on how to see the kennel & the parents of the...
this ad is inactive
25 000 ₦
2012-11-01 Pets Lagos For Sale [P] save
PEDIGREE MASTIFFS ( O E M)Old English Mastiff
I have pedigree old english mastiff,the parents are imported and they are fantastic healthy puppies, They have had all the shots of vaccinations and...
this ad is inactive
150 000 ₦
2012-11-01 Pets Lagos For Sale [P] save
We are importers of several breeds of dogs from South Africa,We are speciazed on large breeds especially,.Like the Neapolitan Mastiff,Cane Corso,Bull...
this ad is inactive
999 999 999.99 ₦
2012-11-01 Pets Lagos For Sale [P] save
I have male and female brindle boerboels for sale.they are 8wks old and package come with a crate,dvd on training,adaptation to the new environment ...
this ad is inactive
140 000 ₦
2012-08-08 Pets Lagos For Sale [P] save
Caucasian dog for sale (5months old)
Female Caucasian puppy dog for sale. Its 5 months old. Registered in a reputable vet. The dog is healthy and very up to date with all vaccinations,...
this ad is inactive
150 000 ₦
2012-08-01 Pets Rivers For Sale [P] save
German Shepherd Puppies for sale
German Shepherd puppies for sale at the cost of 35,000 naira,if you need one please call me 07031378477 on or by mail floatimgship20@gmail. com . . ....
this ad is inactive
35 000 ₦
2012-06-17 Pets Abia For Sale [P] save
boarboal
a very strong blood boarboal 4 sale vall seun keshinro on 08067353946...
this ad is inactive
120 000 ₦
2012-05-22 Pets Lagos For Sale [P] save
Pure Boerboel puppy for sale
I have a 10wks old male boerboel puppy for sale.he has got his vaccination and very healthy....
this ad is inactive
60 000 ₦
2012-05-16 Pets Lagos For Sale [P] save
pedigree 4 real
unbeatable champion blood line, try me, of all breeds we are the leading tested and trusted kennel professional...
this ad is inactive
120 000 ₦
2012-05-01 Pets Lagos For Sale [P] save
PUPPYMICROCHIPPING.ORG
Home About Microchipping Stories of Reunited Dogs Tell Us Your Story Prices and Hours Puppy Microchipping We offer 'Dual Micro chipping' for your...
this ad is inactive
-
2012-04-06 Pets Abuja (FCT) For Sale [P] save
From osodi take a bus heading to iyana-ipaja from iyana-ipaja take another bus going ipaja-ayobo drop at PANDT bus stop asked for adeyemi ebenezer...
this ad is inactive
-
2012-03-31 Pets Ogun Event [P] save
lhasa apso for sale in nigeria
A lhasa apso Íڪ a short toy dog that Íڪ situable  keeps †̥N̤̥̈̊ †ђξ house. Its a dog that can be trained even with children around. I̶̲̥̅̊t has a...
this ad is inactive
70 000 ₦
2012-03-06 Pets Lagos For Sale [C] save
DOGS 4 SALE
I have lhasa apso,german shepherd, rottweiller.for sale; semi adult, adult nd puppies....
this ad is inactive
450 180 ₦
2012-02-14 Pets Lagos For Sale [C] save

See more:

salepuppiespuppydogcutepureboerboeldogsbreedmrhavepedigreecalllikeanyfemaleyouravailablenigerianewetctheandafricaverymaletheystandard000you

Latest Pets Reviews

no reviews found

Latest Pets Review Requests

Please review my ad "cute/pure /full breed boerboel dog/puppy for sale"
Momoh Godwin requested a review of cute/pure /full breed boerboel dog/puppy for sale about 594 days 22 hours ago
Reviews: -
Please review my ad "Pure Brindle Bullmastiff Puppies"
Submit a review
Southridge requested a review of Pure Brindle Bullmastiff Puppies about 1207 days 11 hours ago
Reviews: -
Please review my ad "Lhasa puppies for sale "
Submit a review
Mr Tobi requested a review of Lhasa puppies for sale about 1316 days 18 hours ago
Reviews: -
PROPERTIES
Homes & Townhouses
Leaseholds
Condominiums
Land & Farms
Cottages
Abroad
Other

VEHICLES
Cars
Auto Parts & Accessories
Boats
Boat Parts & Accessories
Motorcycles
Motorcycle Parts & Accessories
Mopeds
Trucks
Caravans & Motorhomes
Forestry & Agricultural Machinery
Bicycles
Other

ELECTRONICS
Cell Phones
Computers & Accessories
Stereo, HIFI & MP3
Video & DVD Players
Cameras & Camcorders
Video Games
Phone & Fax
TV
Other
HOME & HOUSEHOLD
Decoration
Glass, Porcelain & Ceramics
Furniture & Furnishings
Tools & Machinery
Laundry & Dishwashers
Kitchenware
Refrigerators & Freezers
Garden
Firewood
Other

HOBBIES & LEISURE
Movies
Music
Pets
Books & Magazines
Health & Beauty care
Sports & Leisure
Musical Instruments
Hunting
Fishing
Horses & Equestrian
Collectables
Coins & Banknotes
Stamps
Postcards
Tickets & Travel
Antiques & Art
Sewing & Knitting
Other

CHILDREN
Toys
Child Car Seats
Strollers
Children's Furniture
Cloth Diapers
Other
CLOTHING & ACCESSORIES
Jewelry
Watches & Clocks
Women's Clothing
Men's Clothing
Handbags
Children's Wear
Shoes
Other

SERVICES
Education
Garden
Entertainment
Cleaning
Catering
Pastries
Plumbing
Electrical Services
Carpentry
Construction
Painting
Transportation
Movers
Dog-sitting
Babysitting
Body & Hair Care
Accounting & Audit
Other

BUSINESS
Domain Names
Websites
Bankruptcy Clearance Sales
Commercial Real Estate
Office Supplies
Office Equipment
Office Furniture
Store & Restaurant Equipment
Store & Restaurant Furniture
Business for Sale
Industrial Machinery
Shipments
Wholesale Supplies
Other
BUILDING MATERIALS
Timber & Building Boards
Plasterboard & Steel Studs
Roof & Facade
Fastening & Fittings
Paint, Glue & Sealants
Electrical Goods & Power Tools
Foundation & Facade
Heating & Insulation
Windows & Doors
Flooring, Tile & Ceramic Tiles
Kitchen & Home Appliances
Plumbing & Ventilation
Bathroom & Sauna
Drainage & Moisture Protection
Garden & Outdoors
Hand Tools & Instruments
Workwear & Protection
Other

AGRICULTURE
Food Products
Crops
Livestock
Aquaculture
Semen & Embryos
Hay, Feed & Supplements
Veggies & Horticulture
Seeds & Nursery
Fertilizers & Pesticides
Machinery & Equipment
Other

PRECIOUS METALS
Gold Coins
Gold Bullion
Silver Coins
Silver Bullion
Platinum Coins
Platinum Bullion
Palladium Coins
Palladium Bullion
Other
OTHER
Gifts
Wanted
Politics
Make Money Online
Oddities
Other
Free ads on Nigeria's fastest growing classified ads market. Find used Mopeds, Motorcycles och Computers. Nigeria's best Classified Ads are on Advertise.com.ng You can find almost anything for sale at our site. Companies and individuals advertise for free! Don't miss the opportunity to place an ad free!

Both entrepreneurs and individuals advertise for free on Advertise.com.ng. Now with more than 600,000 unique visitors per month!

II logo Innovate it © 2006-2018. All Rights Reserved.
Question

Do you already have an account on Advertise.com.ng?

Log in

To modify your ad and other data
you must log in.

Forgot password?

Not registered? .

Login or signup with your facebook account